Healing & Recovery

VIP

Vasoactive Intestinal Peptide

VIP is a 28-amino-acid neuropeptide isolated by Said and Mutt in 1970. It acts at VPAC1/VPAC2 and is a potent vasodilator with a minutes-class IV half-life. Intranasal research use shows up in Shoemaker CIRS open-label work (n=20, 2013), which is not a Phase 3 trial. Aviptadil (synthetic VIP) had separate pulmonary development. This page is identity and honesty, not a mold-illness cure.

Not FDA-approved - research chemical
Reviewed by CalcMyPeptide Editorial Team
Last updated: August 2026Evidence: Low3 peer-reviewed citations
Typical research dose
50-200 mcg (intranasal)
Frequency
1-2× daily (intranasal)
Half-life
~1–2 min IV; intranasal is a different presentation, not a published consumer PK curve
Common vials
N/A (oral)
CAS
37221-79-7
Molecular weight
3326.79 g/mol

Use-case scores

0–10 against the evidence we have, not a gym ranking. Hidden domains do not apply here.

  • Immune4/10

    VPAC immunoregulation is real physiology. The CIRS open-label n=20 sits at small-human / community after honesty haircuts. Not a 6.5 without a controlled trial.

Compound card

Sequence
28-aa VIP (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2)
Class
Endogenous VPAC1/VPAC2 neuropeptide
Formula
C147H237N43O43S
Status
Not FDA-approved · research use

How it works

VIP is a 28-residue neuropeptide isolated by Said and Mutt from porcine intestine (Science 1970, PMID 5450698). It is a potent vasodilator and a VPAC1/VPAC2 agonist with a minutes-class IV half-life. That physiology is not in dispute.

What this catalog page is usually asked to do is CIRS / mold / “Shoemaker protocol” nasal VIP. The 2013 open-label series (Health, DOI 10.4236/health.2013.53053, n=20) is that literature. It is not a Phase 3 RCT, not PubMed 28694751 (that PMID was a bad citation on this leaf), and not a reason to skip the rest of a clinician-run workup. Aviptadil is synthetic VIP in pulmonary development; it is not a research-chem nasal spray.

This site will not treat CIRS, MCAS, PAH, or Long COVID from a peptide page.

Source: PMID: 15271596

Not a reconstitution peptide on this site

VIP is typically a compounded nasal spray in the use-case people search. This database has no vial size. Do not force spray math into the SubQ calculator.

Goal context

CIRS as a clinic protocol, not a SKU

Shoemaker’s sequence puts VIP last, after exposure control and other steps, with lipase monitoring in that playbook. A peptide page cannot run that protocol.

Vasodilation is the side effect and the mechanism

Flushing and blood-pressure drop are expected pharmacology. First-dose hypotension is why clinic protocols watch the first spray.

Background & History

VIP is a 28-aa neuropeptide isolated by Said and Mutt in 1970. Minutes-class IV half-life, potent vasodilator, VPAC1/VPAC2. Nasal CIRS use is an open-label 2013 series (n=20), not a Phase 3. PMID 28694751 does not identify that paper. Aviptadil is a different development path. Not a reconstitution peptide in this database.

Research Use Cases

  • ✓VIP identity and VPAC physiology
  • ✓Understanding why CIRS clinics use a spray (not a SubQ calculator)
  • ✓Not a mold-illness, MCAS, PAH, or Long-COVID cure page

Dosing

PhaseDoseFrequencyNotes
Shoemaker-style nasal (clinic playbook, unlabeled as a drug)50 mcgUp to 4× daily intranasal in that protocolCopied from the 2013 open-label paper’s starting cadence. Not an FDA label. First dose in-office in that playbook.

Administration

Route / form
Intranasal spray in the CIRS use-case. IV is drug-development / research, not this calculator.
Timing
Spread through the day in that playbook. No fasting requirement.
Empty stomach?
No - Food timing is not critical.

Timeline

Open-label 2013 series
Authors reported biomarker and symptom change over months. That is not a consumer guarantee.
Minutes after a spray
Vasodilation can show up immediately. That is VIP, not “detox.”

Who it is for

Need VIP identity

Moderate

This is the 28-mer. Physiology is real.

Need a mold-illness cure

Low

Wrong page.

Safety & Considerations

Potent vasodilator. Hypotension, flushing, diarrhea are class effects. Active diarrhea is a reason to stop in clinic playbooks that also watch lipase. Research/compounded nasal VIP is not aviptadil. Not for unsupervised first-dose heroics.

Regulatory & Legal Status

FDA Status (US)
Research Only
WADA Status (2026)
Not Listed

Not currently on the WADA 2026 Prohibited List. Policies may change - verify before competition.

Classification

Research Chemical

US Compounding: Not eligible / not available

⚠️ This information is for educational purposes only and may not reflect the most current regulatory updates. Always verify with official FDA, WADA, and jurisdiction-specific sources before use.

Limits of current evidence

  • Shoemaker 2013 is open-label n=20 in a non-NEJM journal. Durable-efficacy language in that paper is the authors’. It is not a regulator’s.
  • PMID 28694751 does not identify that paper. Cite the 2013 Health DOI instead of a hallucinated PMID.
  • Aviptadil / PAH / COVID development is a different product path.
  • IV half-life of minutes is why nasal or infusion exists. It is not a SubQ recovery depot.
  • This leaf has no vial fill in the calculator database. Do not invent one.

Verdict

VIP is a real neuropeptide with a 1970 isolation paper. Nasal CIRS use is an open-label clinic protocol, not a Phase 3. Do not put a spray into the reconstitution calculator, and do not treat mold illness from this leaf.

Interactions & Contraindications

Vasodilation / hypotension, especially with antihypertensives. Diarrhea and lipase watching appear in CIRS playbooks. First-dose blood pressure is the practical hazard.

Synergies & Common Stacks

+ KPV →

Both show up in inflammatory folklore. Different receptors. Not a combination trial.

Frequently Asked Questions

Is VIP a recovery peptide?▼
This catalog filed it there. Physiology is VPAC/vasodilation/immune. The score bar is immune, not tendon.
Does nasal VIP cure CIRS?▼
The 2013 open-label n=20 paper is what people mean. It is not a Phase 3. Exposure control still comes first in that playbook.
What PMID is the Shoemaker VIP paper?▼
Do not use 28694751. The paper is Health 2013, DOI 10.4236/health.2013.53053.
Can I reconstitute a VIP vial in the calculator?▼
This database has no vial fill. Typical SKU is a spray. Do not invent SubQ math.
Is this aviptadil?▼
Aviptadil is synthetic VIP in pulmonary trials. Different development path, different product.
Why is the half-life 2 minutes?▼
Native VIP is built to act and vanish. That is why nasal and infusion exist.
First-dose caution?▼
Vasodilation. Clinic protocols watch blood pressure and, in the CIRS playbook, lipase. Do not freelance that.
FDA-approved?▼
Native VIP as a CIRS spray is not an FDA-approved mold drug. Separate VIP analogs had their own programs.

References

  1. Said SI, Mutt V “Polypeptide with broad biological activity: isolation from small intestine.” Science (1970). PMID: 5450698
  2. Shoemaker RC, House D, Ryan JC “Vasoactive intestinal polypeptide (VIP) corrects chronic inflammatory response syndrome (CIRS) acquired following exposure to water-damaged buildings.” Health (2013). DOI: 10.4236/health.2013.53053
  3. Petkov V, et al. “Vasoactive intestinal peptide as a new drug for treatment of primary pulmonary hypertension.” J Clin Invest (2003). PMID: 12618522
Recommended source10% OFF

Get VIP from our recommended source - independently tested, COA-verified, USP <85> endotoxin compliant. Use code 4SS6SFTUGB at checkout.

Buy VIPSee all sources →

Affiliate link · Full review

← Back to Peptide Library